Recombinant Human ZNF629 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UEG4

Gene Name: ZNF629

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Ser741

End Site: Lys840

Coverage: 0.12

Isoelectric Point: 6.5

Core Sequence: SSQKSPELGKSSSVLLEHLRSPLGARPYRCSDCRASFLDRVALTRHQETHTQEKPPNPEDPPPEAVTLSTDQEGEGETPTPTESSSHGEGQNPKTLVEEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 34%, Pig - 73%, Cynomolgus monkey - 87%

Alternative gene names: KIAA0326; ZNF65

Alternative protein names: Zinc finger protein 629; Zinc finger protein 65

Protein name: zinc finger protein 629

Full length: 869 amino acids

Entry name: ZN629_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2887-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2887-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 23361