Recombinant Human ZNF703 Protein

Recombinant Human ZNF703 Protein
SKU
ASBPP-2771-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H7S9

Gene Name: ZNF703

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Gly61

End Site: Lys280

Coverage: 0.39

Isoelectric Point: 8

Core Sequence: GHLLHPEYLQPLSSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNSVAAAANGLGAEKDPGRSAPGAASAAAALKQLGDSPAEDKSSFKPYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSSSPGGSRGGSPHHSDCKNGGGVGGGELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 96%

Alternative gene names: ZEPPO1; ZPO1

Alternative protein names: Zinc finger protein 703; Zinc finger elbow-related proline domain protein 1

Protein name: zinc finger protein 703

Full length: 590 amino acids

Entry name: ZN703_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2771-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2771-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 80139
Product information (PDF)
×
MSDS (PDF)
×