Recombinant Swine IFN gamma protein(N-His)(active)

Recombinant Swine IFN gamma protein(N-His)(active)
SKU
ELSPKSS000012-5
Packaging Unit
5 µg
Manufacturer
Elabscience Biotechnology

Availability: loading...
Price is loading...
Abbreviation: IFN gamma

Target Synonym: IFN-gamma;IFNG

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: P17803

Background: IFNγ is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them; leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens; mitogens; or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNγ synthesis is induced by IL-2; FGF-basic; and EGF.

Activity: Measure by its ability to protect PK15 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 40 pg/mL.

Sequence: MSYTTYFLAFQLCVTLCFSGSYCQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK

Purity: > 95 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Endotoxin: Please contact us for more information.
More Information
SKU ELSPKSS000012-5
Manufacturer Elabscience Biotechnology
Manufacturer SKU ELA-PKSS000012-5
Package Unit 5 µg
Quantity Unit STK
Application Cell Culture
Product information (PDF) Download
MSDS (PDF) Download