Recombinant Swine IL-1 beta protein(N-His)(active)

Recombinant Swine IL-1 beta protein(N-His)(active)
SKU
ELSPKSS000002-5
Packaging Unit
5 µg
Manufacturer
Elabscience Biotechnology

Availability: loading...
Price is loading...
Abbreviation: IL-1 beta

Target Synonym: IL1B1;IL1B

Target Species: Porcine

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: P26889

Background: Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family. IL1 is a pleiotropic cytokine. It is involved in the inflammatory response, cell growth, and tissue repair in the cortex. The IL1 superfamily consists of three members, IL1A (IL1 alpha), IL1B (IL1 beta), and IL1 receptor antagonist (IL1Ra). In clinical, it has been reported that Interleukin (IL)-1 may influence Th1 / Th2 immune responsiveness and has been implicated in the establishment of successful pregnancy. Proinflammatory interleukin (IL)-1 gene polymorphisms associated with high levels of IL-1beta activity increase the risk for hypochlorhydria and distal gastric carcinoma. IL1B polymorphisms may be involved in susceptibility to SSc. Moreover, the IL2-384-G allele may be a marker for the limited phenotype of systemic sclerosis (SSc).

Activity: Measure by its ability to induce D10.G4. 1 cells proliferation. The ED50 for this effect is 3 ng/mL.

Sequence: MAIVPEPAKEVMANYGDNNNDLLFEADGPKEMKCCTQNLDLGSLRNGSIQLQISHQLWNKSIRQMVSVIVAVEKPMKNPSSQAFCDDDQKSIFSFIFEEEPIILETCNDDFVCDANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Endotoxin: Please contact us for more information.
More Information
SKU ELSPKSS000002-5
Manufacturer Elabscience Biotechnology
Manufacturer SKU ELA-PKSS000002-5
Package Unit 5 µg
Quantity Unit STK
Application Cell Culture
Product information (PDF) Download
MSDS (PDF) Download