REM1 Antibody - N-terminal region : Biotin

REM1 Antibody - N-terminal region : Biotin
SKU
AVIARP54963_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human REM1

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTP-binding protein REM 1

Protein Size: 298

Purification: Affinity Purified
More Information
SKU AVIARP54963_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54963_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 28954
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×