CSTB Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: CSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CSTB

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: ADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cystatin-B

Protein Size: 98

Purification: Affinity Purified

• SKU: AVIARP59177_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59177_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Sheep (Ovine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 1476
• Host: Rabbit