ACAP2 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ACAP2 is a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6).

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACAP2

Key Reference: N/A

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: ARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2

Protein Size: 778

Purification: Affinity purified

• SKU: AVIARP54874_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54874_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23527
• Host: Rabbit