ACBD7 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACBD7

Key Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acyl-CoA-binding domain-containing protein 7

Protein Size: 88

Purification: Affinity Purified

• SKU: AVIARP56265_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56265_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 414149
• Host: Rabbit