ACHE Antibody - middle region : FITC

ACHE Antibody - middle region : FITC
SKU
AVIARP56762_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood gro

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACHE

Key Reference: * Discovery and initial validation of α 1-B glycoprotein fragmentation as a differential urinary biomarker in pediatric steroid-resistant nephrotic syndrome. Piyaphanee N, et al. Proteomics Clin Appl, 2011 Jun.
* Human CRISP-3 binds serum alpha(1)B-glycoprotein across species. Udby L, et al. Biochim Biophys Acta, 2010 Apr.
* Proteomic analysis identifies MMP-9, DJ-1 and A1BG as overexpressed proteins in pancreatic juice from pancreatic ductal adenocarcinoma patients. Tian M, et al. BMC Cancer, 2008 Aug 16.
* Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Liu T, et al. J Proteome Res, 2005 Nov-Dec.
* The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, et al. Genome Res, 2004 Oct.

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acetylcholinesterase

Protein Size: 614

Purification: Affinity Purified
More Information
SKU AVIARP56762_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56762_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 43
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×