ACHE Antibody - N-terminal region : Biotin

ACHE Antibody - N-terminal region : Biotin
SKU
AVIARP56761_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Acetylcholinesterase hydrolyzes the neurotransmitter, acetylcholine at neuromuscular junctions and brain cholinergic synapses, and thus terminates signal transmission. It is also found on the red blood cell membranes, where it constitutes the Yt blood gro

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACHE

Key Reference: Johnson,G., (2008) Biochem. J. 411 (3), 507-514

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acetylcholinesterase

Protein Size: 617

Purification: Affinity Purified
More Information
SKU AVIARP56761_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56761_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Immunofluorescence, Western Blotting, Immunohistochemistry
Human Gene ID 43
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×