ADGRG1 Antibody - N-terminal region : Biotin

ADGRG1 Antibody - N-terminal region : Biotin
SKU
AVIARP58627_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPR56

Key Reference: Ke,N., (2008) Biochem. Biophys. Res. Commun. 366 (2), 314-320

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: adhesion G-protein coupled receptor G1

Protein Size: 693

Purification: Affinity Purified
More Information
SKU AVIARP58627_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58627_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9289
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×