AGK Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: AGK is a lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. AGK does not phosphorylate sphingosine. Overexpression of AGK increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AGK

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: DNLLRRAACQEAQVFGNQLIPPNAQVKKATVFLNPAACKGKARTLFEKNA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acylglycerol kinase, mitochondrial

Protein Size: 422

Purification: Affinity Purified

• SKU: AVIARP57169_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57169_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55750
• Host: Rabbit