ANGPTL5 Antibody - N-terminal region : Biotin

ANGPTL5 Antibody - N-terminal region : Biotin
SKU
AVIARP55766_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact functions of ANGPTL5 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPTL5

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Angiopoietin-related protein 5

Protein Size: 388

Purification: Affinity Purified
More Information
SKU AVIARP55766_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55766_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 253935
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×