ANKRD39 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of ANKRD39 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD39

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: IWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat domain-containing protein 39

Protein Size: 183

Purification: Affinity Purified

• SKU: AVIARP56912_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56912_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51239
• Host: Rabbit