Uniprot: P15144
Gene Name: ANPEP
Immunogen: Recombinant human ANPEP
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 85%
Core Sequence: DKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMK
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 83%, Pig - 82%, Cynomolgus monkey - 94%
Alternative gene names: APN；CD13；PEPN
Alternative protein names: Aminopeptidase N; AP-N; hAPN; Alanyl aminopeptidase; Aminopeptidase M; AP-M; Microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; gp150; CD antigen CD13
Protein name: Alanyl aminopeptidase,membrane
CD Antigen: CD13
Product panel: IHC Pathology,CD Antigen
Clone No.: K29035_18H9
Antigen Species: Human
Target Name: ANPEP
IHC Verification: -
IHC Dilution: N/A
WB Verification: succeed
WB Dilution: 1:1000
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: PP-181
Cross reactivity: Not tested
English
Deutsch
