Anti-ITGA2

integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor), Polyclonal, IgG, Rabbit
SKU
ATLHPA063556-25
Packaging Unit
25 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...

Artikel in Aktion bis 31. August 2024. Bitte führen sie den Aktionscode Pancer bei der Bestellung an um 15% Rabatt für diesen Artikel zu erhalten.



GeneName: ITGA2

Enhanced Validation: Yes

Concentration: 0.1

Sequence: ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV

Interspecies Mouse/Rat: ENSRNOG00000058111: 80%, ENSMUSG00000015533: 78%

Entrez Gene ID: 3673

UniProt ID: P17301

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000164171
More Information
SKU ATLHPA063556-25
Manufacturer Atlas Antibodies
Manufacturer SKU HPA063556-25
Green Labware No
Package Unit 25 µl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Isotype IgG
Human Gene ID 3673
Host Rabbit
Product information (PDF) Download
MSDS (PDF) Download