Anti-ITGA2B

integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41), Polyclonal, IgG, Rabbit
SKU
ATLHPA031169-25
Packaging Unit
25 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...

Artikel in Aktion bis 31. August 2024. Bitte führen sie den Aktionscode Pancer bei der Bestellung an um 15% Rabatt für diesen Artikel zu erhalten.



GeneName: ITGA2B

Enhanced Validation: Yes

Concentration: 0.1

Sequence: NDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVG

Interspecies Mouse/Rat: ENSRNOG00000022071: 76%, ENSMUSG00000034664: 74%

Entrez Gene ID: 3674

UniProt ID: P08514

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000005961
More Information
SKU ATLHPA031169-25
Manufacturer Atlas Antibodies
Manufacturer SKU HPA031169-25
Green Labware No
Package Unit 25 µl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Immunohistochemistry
Isotype IgG
Human Gene ID 3674
Host Rabbit
Product information (PDF) Download
MSDS (PDF) Download