Anti-KIT

v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, Polyclonal, IgG, Rabbit
SKU
ATLHPA004471-25
Packaging Unit
25 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Please fill out the
×
to request up to 3 samples.

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.



GeneName: KIT

Enhanced Validation: No

Concentration: 0.2

Sequence: VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ

Interspecies Mouse/Rat: ENSMUSG00000005672: 66%, ENSRNOG00000002227: 72%

Entrez Gene ID: 3815

UniProt ID: P10721

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000157404
More Information
SKU ATLHPA004471-25
Manufacturer Atlas Antibodies
Manufacturer SKU HPA004471-25
Package Unit 25 µl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Immunohistochemistry
Isotype IgG
Human Gene ID 3815
Host Rabbit
Product information (PDF) Download
MSDS (PDF) Download