Anti-KIT

v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, Polyclonal, IgG, Rabbit

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.

GeneName: KIT

Enhanced Validation: No

Concentration: 0.2

Sequence: VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ

Interspecies Mouse/Rat: ENSMUSG00000005672: 66%, ENSRNOG00000002227: 72%

Entrez Gene ID: 3815

UniProt ID: P10721

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000157404

• SKU: ATLHPA004471-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA004471-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 3815
• Host: Rabbit