Anti-PTEN

phosphatase and tensin homolog, Polyclonal, IgG, Rabbit
SKU
ATLHPA031335-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...

Artikel in Aktion bis 31. August 2024. Bitte führen sie den Aktionscode Pancer bei der Bestellung an um 15% Rabatt für diesen Artikel zu erhalten.



GeneName: PTEN

Enhanced Validation: No

Concentration: 0.05

Sequence: VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT

Interspecies Mouse/Rat: ENSMUSG00000013663: 100%, ENSRNOG00000020723: 100%

Entrez Gene ID: 5728

UniProt ID: P60484

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000171862
More Information
SKU ATLHPA031335-100
Manufacturer Atlas Antibodies
Manufacturer SKU HPA031335-100
Green Labware No
Package Unit 100 µl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunocytochemistry
Isotype IgG
Human Gene ID 5728
Host Rabbit
Product information (PDF) Download
MSDS (PDF) Download