Apbb1 Antibody - N-terminal region : Biotin

Apbb1 Antibody - N-terminal region : Biotin
SKU
AVIARP55471_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Apbb1 is an adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain.Apbb1 plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. Apbb1 may act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as MAPK8/JNK1. Apbb1 is required for histone H4 acetylation at double-strand breaks (DSBs). Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, probably explains its trancription activation activity.Apbb1 functions in association with TSHZ3, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. Apbb1 is associates with chromatin in a region surrounding the CASP4 transcriptional start site(s).

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: DGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amyloid beta A4 precursor protein-binding family B member 1

Protein Size: 708

Purification: Affinity Purified
More Information
SKU AVIARP55471_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55471_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 11785
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×