APBB2 Antibody - middle region : Biotin

APBB2 Antibody - middle region : Biotin
SKU
AVIARP55624_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: APBB2 may modulate the internalization of beta-amyloid precursor protein.The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APBB2

Key Reference: Hong,Q., (er) BMC Mol. Biol. 8, 50 (2007)

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amyloid beta A4 precursor protein-binding family B member 2

Protein Size: 736

Purification: Affinity Purified
More Information
SKU AVIARP55624_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55624_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 323
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×