APIP Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human APIP

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: AARSDEIYIAPSGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable methylthioribulose-1-phosphate dehydratase

Protein Size: 204

Purification: Affinity Purified

• SKU: AVIARP56788_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56788_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51074
• Host: Rabbit