App Antibody - C-terminal region : Biotin

App Antibody - C-terminal region : Biotin
SKU
AVIARP58851_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: App functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. It is involved in cell mobility and transcription regulation through protein-protein interactions.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human App

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amyloid beta A4 protein

Protein Size: 751

Purification: Affinity Purified
More Information
SKU AVIARP58851_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58851_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 11820
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×