Arf4 Antibody - N-terminal region : HRP

Arf4 Antibody - N-terminal region : HRP
SKU
AVIARP56032_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Arf4 is an GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. It is Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADP-ribosylation factor 4

Protein Size: 180

Purification: Affinity Purified

Specificity#: This antibody is predicted to react to human ARF1,3,4,5 (100% homology) and 6 (93%).
More Information
SKU AVIARP56032_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56032_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 11843
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×