ARHGEF26 Antibody - N-terminal region : HRP

ARHGEF26 Antibody - N-terminal region : HRP
SKU
AVIARP55292_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SGEF activates RhoG GTPase by promoting the exchange of GDP by GTP. SGEF is required for the formation of membrane ruffles during macropinocytosis. SGEF is also required for the formation of cup-like structures during trans-endothelial migration of leukocyte.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SGEF

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho guanine nucleotide exchange factor 26

Protein Size: 871

Purification: Affinity Purified
More Information
SKU AVIARP55292_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55292_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine), Yeast
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26084
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×