ARMC8 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of ARMC8 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARMC8

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Armadillo repeat-containing protein 8

Protein Size: 385

Purification: Affinity Purified

• SKU: AVIARP56018_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56018_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 25852
• Host: Rabbit