Arsg Antibody - middle region : HRP

Arsg Antibody - middle region : HRP
SKU
AVIARP55121_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Arsg displays arylsulfatase activity with pseudosubstrates at acidic pH, such as p-nitrocatechol sulfate.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Arsg

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: LAEVLQQAGYVTAMIGKWHLGHHGSYHPSFRGFDYYFGIPYSNDMGCTDN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Arylsulfatase G

Protein Size: 526

Purification: Affinity Purified
More Information
SKU AVIARP55121_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55121_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 303631
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×