ASH2L Antibody - N-terminal region : Biotin

ASH2L Antibody - N-terminal region : Biotin
SKU
AVIARP58133_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ASH2L is a component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. It as part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. It may function as a transcriptional regulator. And it May play a role in hematopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ASH2L

Key Reference: N/A

Molecular Weight: 69 kDa

Peptide Sequence: Synthetic peptide located within the following region: GPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Set1/Ash2 histone methyltransferase complex subunit ASH2

Protein Size: 628

Purification: Affinity purified
More Information
SKU AVIARP58133_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58133_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9070
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×