ASH2L Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ASH2L is a component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. It as part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. It may function as a transcriptional regulator. And it May play a role in hematopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ASH2L

Key Reference: N/A

Molecular Weight: 69 kDa

Peptide Sequence: Synthetic peptide located within the following region: GPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Set1/Ash2 histone methyltransferase complex subunit ASH2

Protein Size: 628

Purification: Affinity purified

• SKU: AVIARP58133_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58133_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9070
• Host: Rabbit