ASXL2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax (see MIM 159555) and polycomb (see MIM 610231) (ETP) gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing (Katoh and Katoh, 2003 [PubMed 12888926]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ASXL2

Molecular Weight: 154kDa

Peptide Sequence: Synthetic peptide located within the following region: EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative Polycomb group protein ASXL2

Protein Size: 1435

Purification: Affinity Purified

• SKU: AVIARP57184_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57184_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55252
• Host: Rabbit