ATG4C Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG4C

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cysteine protease ATG4C

Protein Size: 458

Purification: Affinity Purified

• SKU: AVIARP58863_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58863_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 84938
• Host: Rabbit