BANK1 Antibody

Uniprot: Q8NDB2

Gene Name: BANK1

Immunogen: Recombinant human BANK1

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 69%

Core Sequence: PGTMVEGQMERSQNWGHPGVRQETGDEPKGEKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKKTGSRSFIINRPPAPTPRPTSIPPKEETTPYIAQVFQQKTARRQSDDDKFCGLPKKQDRARIESPAFSTLRGCLTDGQEELILLQEKVKNG

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 69%, Pig - 79%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: B-cell scaffold protein with ankyrin repeats

Protein name: B cell scaffold protein with ankyrin repeats 1

Clone No.: K92023_4F1

Antigen Species: Human

Target Name: BANK1

IHC Verification: succeed

IHC Dilution: 1:100~1:200

WB Verification: -

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-911

Cross reactivity: Not tested

• SKU: ASBKC-1003-50
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KC-1003-50
• Package Unit: 50 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunohistochemistry, Immunocytochemistry
• Isotype: IgG1
• Human Gene ID: 55024
• Host: Mouse
• Conjugate: Unconjugated