BPNT1 Antibody - N-terminal region : Biotin

BPNT1 Antibody - N-terminal region : Biotin
SKU
AVIARP58597_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BPNT1

Key Reference: Spiegelberg,B.D., (1999) J. Biol. Chem. 274 (19), 13619-13628

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 3'(2'),5'-bisphosphate nucleotidase 1

Protein Size: 261

Purification: Affinity Purified
More Information
SKU AVIARP58597_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58597_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10380
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×