C15orf15 Antibody - middle region : Biotin

C15orf15 Antibody - middle region : Biotin
SKU
AVIARP56884_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C15orf15

Key Reference: 0

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: KCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable ribosome biogenesis protein RLP24

Protein Size: 163

Purification: Affinity Purified
More Information
SKU AVIARP56884_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56884_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51187
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×