C19orf62 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of C19orf62 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf62

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: BRISC and BRCA1-A complex member 1

Protein Size: 329

Purification: Affinity Purified

Subunit: MERIT40

• SKU: AVIARP54986_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54986_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 29086
• Host: Rabbit