C1orf103 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf103

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ligand-dependent nuclear receptor-interacting factor 1

Protein Size: 233

Purification: Affinity Purified

• SKU: AVIARP56173_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56173_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55791
• Host: Rabbit