C1orf144 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf144

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SUZ domain-containing protein 1

Protein Size: 133

Purification: Affinity Purified

• SKU: AVIARP55304_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55304_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 26099
• Host: Rabbit