C2orf25 Antibody - middle region : FITC

C2orf25 Antibody - middle region : FITC
SKU
AVIARP55333_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of C2orf25 remains unknown.Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism (Coelho et al., 2008 [PubMed 18385497]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf25

Key Reference: Coelho,D., (2008) N. Engl. J. Med. 358 (14), 1454-1464

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methylmalonic aciduria and homocystinuria type D protein, mitochondrial

Protein Size: 296

Purification: Affinity Purified
More Information
SKU AVIARP55333_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55333_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27249
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×