C2orf25 Antibody - N-terminal region : HRP

C2orf25 Antibody - N-terminal region : HRP
SKU
AVIARP55332_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of C2orf25 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf25

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Methylmalonic aciduria and homocystinuria type D protein, mitochondrial

Protein Size: 296

Purification: Affinity Purified
More Information
SKU AVIARP55332_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55332_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27249
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×