CARD8 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CARD8

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase recruitment domain-containing protein 8

Protein Size: 286

Purification: Affinity Purified

• SKU: AVIARP55119_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55119_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22900
• Host: Rabbit