CASP1 Antibody - middle region : Biotin

CASP1 Antibody - middle region : Biotin
SKU
AVIARP58983_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing of this gene results in five transcript variants encoding distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP1

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-1

Protein Size: 383

Purification: Affinity Purified
More Information
SKU AVIARP58983_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58983_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 834
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×