CASP4 Antibody - middle region : FITC

CASP4 Antibody - middle region : FITC
SKU
AVIARP58991_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CASP4

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: CGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-4

Protein Size: 321

Purification: Affinity Purified
More Information
SKU AVIARP58991_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58991_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 837
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×