CCDC190 Antibody - middle region : Biotin

CCDC190 Antibody - middle region : Biotin
SKU
AVIARP55776_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf110

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: SKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: coiled-coil domain-containing protein 190

Protein Size: 302

Purification: Affinity Purified
More Information
SKU AVIARP55776_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55776_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 339512
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×