CCDC87 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC87

Key Reference: 0

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 87

Protein Size: 849

Purification: Affinity Purified

• SKU: AVIARP57157_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57157_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55231
• Host: Rabbit