Cd247 Antibody - C-terminal region : Biotin

Cd247 Antibody - C-terminal region : Biotin
SKU
AVIARP59100_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Cd247 is a component of T cell receptor (TCR) complex that plays a role in TCR assembly and signaling; It does not promote surface expression of Fc gamma RIII, unlike human homolog.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Cd247

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: ALQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 137

Purification: Affinity Purified
More Information
SKU AVIARP59100_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59100_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25300
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×