CD8A Antibody - middle region : HRP

CD8A Antibody - middle region : HRP
SKU
AVIARP59114_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a corepressor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains, or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain isoforms. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD8A

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: GKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: T-cell surface glycoprotein CD8 alpha chain

Protein Size: 235

Purification: Affinity Purified
More Information
SKU AVIARP59114_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59114_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 925
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×