Cdc42ep4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GSPKSPHRNGATGPHSPDPLLDEQAFGDLMDLPVMPKVSYGLKHAESILS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: CDC42 effector protein (Rho GTPase binding) 4 (Predicted), isoform CRA_a EMBL EDM06527.1

Protein Size: 350

Purification: Affinity Purified

• SKU: AVIARP54840_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54840_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 303653
• Host: Rabbit