Cdk5rap1 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Cdk5rap1 is a probable regulator of CDK5 activity. It may inhibit CDK5 function via its interaction with CDK5R1.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: CDK5 regulatory subunit-associated protein 1

Protein Size: 586

Purification: Affinity Purified

Subunit: -associated protein 1

• SKU: AVIARP56907_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56907_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 252827
• Host: Rabbit