CDK5RAP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A. The protein encoded by this gene binds to p25NCK5A and therefore may be involved in

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDK5RAP1

Key Reference: Lehner,B. (2004) Genome Res. 14 (7), 1315-1323

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CDK5 regulatory subunit-associated protein 1

Protein Size: 497

Purification: Affinity Purified

Subunit: -associated protein 1

• SKU: AVIARP56906_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56906_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51654
• Host: Rabbit