CFAP97 Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA1430

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cilia- and flagella-associated protein 97

Protein Size: 532

Purification: Affinity Purified

• SKU: AVIARP57463_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57463_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57587
• Host: Rabbit